Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0023 (MJ0023)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0023 (MJ0023) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0023

UniProt

Q60333

Expression Region

1-118

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSIRISSDYRAKRDNASCFDETFLKSFAEELYNAIIEIIKENKTIIKNEVRDELRNELA TKEDILLVEERLGKKIELLNQKIEREIKLVRRDMIIINLVIILAMYAPEIIGKLLIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protonitazene Dihydrochloride
TRC-P756325-5MG 5 mg

Protonitazene Dihydrochloride

Sign In for Pricing
View Details
CD31 Recombinant Chimeric Antibody Antibody
HA751615 100 µL

CD31 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS642483 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS630450 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Bmerb1 Mouse Gene Knockout Kit (CRISPR)
KN500304 1 Kit

Bmerb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), CF594 conjugate, 0.1mg/mL
BNC942047-100 1x 100 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details