Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0023 (MJ0023)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0023 (MJ0023) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0023

UniProt

Q60333

Expression Region

1-118

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSIRISSDYRAKRDNASCFDETFLKSFAEELYNAIIEIIKENKTIIKNEVRDELRNELA TKEDILLVEERLGKKIELLNQKIEREIKLVRRDMIIINLVIILAMYAPEIIGKLLIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF647 conjugate, 0.1mg/mL
BNC472034-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Acvr1 activation kit by CRISPRa
GA200052 1 Kit

Mouse Acvr1 activation kit by CRISPRa

Sign In for Pricing
View Details
Twist1 Mouse Gene Knockout Kit (CRISPR)
KN318498LP 1 Kit

Twist1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Pcgf1 activation kit by CRISPRa
GA208343 1 Kit

Mouse Pcgf1 activation kit by CRISPRa

Sign In for Pricing
View Details
BglII, 300U
RV1144 300 U

BglII, 300U

Sign In for Pricing
View Details
2’,3’-Di-O-acetyl-5’-deoxy-5-fluoro-N4-(pentoxy-d11-carbonxyl)cytidine
TRC-D322627-1MG 1 mg

2’,3’-Di-O-acetyl-5’-deoxy-5-fluoro-N4-(pentoxy-d11-carbonxyl)cytidine

Sign In for Pricing
View Details