Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0023 (MJ0023)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0023 (MJ0023) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0023

UniProt

Q60333

Expression Region

1-118

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSIRISSDYRAKRDNASCFDETFLKSFAEELYNAIIEIIKENKTIIKNEVRDELRNELA TKEDILLVEERLGKKIELLNQKIEREIKLVRRDMIIINLVIILAMYAPEIIGKLLIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Lung
CD563902 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
CTNNBL1 (NM_030877) Human Over-expression Lysate
LC403090 20 µg

CTNNBL1 (NM_030877) Human Over-expression Lysate

Sign In for Pricing
View Details
SCGB1D4 Human Gene Knockout Kit (CRISPR)
KN419647 1 Kit

SCGB1D4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C9orf95 (NMRK1) (NM_001127603) Human Over-expression Lysate
LC426819 20 µg

C9orf95 (NMRK1) (NM_001127603) Human Over-expression Lysate

Sign In for Pricing
View Details
RAI3 (GPRC5A) (NM_003979) Human Over-expression Lysate
LC401304 20 µg

RAI3 (GPRC5A) (NM_003979) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human PRRG2 Protein (Fc Tag)
PKSH030464 100 µg

Recombinant Human PRRG2 Protein (Fc Tag)

Sign In for Pricing
View Details