Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L20 (MIMI_L20)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L20 (MIMI_L20) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein L20

UniProt

Q5UP90

Expression Region

1-118

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKNMMENMNNKKIAMIIIIFYVITSMVQGNYHFAILGAYFIIKNIFEYKFNKGIELPSI NYTIIGTIIGQYTVLIIMIFCRDNFSDNPYIEQILTTNLSIVGYAFGSFWYRCITTQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR26 Rabbit Polyclonal Antibody (BF488)
orb1592458 100 µL

WDR26 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Tubulin polymerization assay using >99% pure tubulin - fluorescence based (BK011P)
BK011P 96 Assays/Kit

Tubulin polymerization assay using >99% pure tubulin - fluorescence based (BK011P)

Sign In for Pricing
View Details
APOC3 Rabbit Polyclonal Antibody
orb1545781-01 50 μL

APOC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APOC3 Rabbit Polyclonal Antibody
orb1545781-02 100 µL

APOC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Nuclear Receptor Coactivator 3 (NCOA3) ELISA Kit
RDR-NCOA3-Hu-48Tests 48 Tests

Human Nuclear Receptor Coactivator 3 (NCOA3) ELISA Kit

Sign In for Pricing
View Details
6-Bromo-1-ethyl-2,3-dihydro-1H-indole-2,3-dione
WMB11272-01 50 mg

6-Bromo-1-ethyl-2,3-dihydro-1H-indole-2,3-dione

Sign In for Pricing
View Details