Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L20 (MIMI_L20)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L20 (MIMI_L20) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein L20

UniProt

Q5UP90

Expression Region

1-118

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKNMMENMNNKKIAMIIIIFYVITSMVQGNYHFAILGAYFIIKNIFEYKFNKGIELPSI NYTIIGTIIGQYTVLIIMIFCRDNFSDNPYIEQILTTNLSIVGYAFGSFWYRCITTQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNL1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
22335064 1.0 µg DNA

GNL1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TASK-2 CRISPR Activation Plasmid (h)
sc-408166-ACT 20 µg

TASK-2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Rat REG3a (Regenerating Islet Derived Protein 3 Alpha) ELISA Kit
EK245947 96 Well

Rat REG3a (Regenerating Islet Derived Protein 3 Alpha) ELISA Kit

Sign In for Pricing
View Details
N-Fmoc-Freidinger's lactam
sc-301349 500 mg

N-Fmoc-Freidinger's lactam

Sign In for Pricing
View Details
KIRREL3-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV730411 1.0 µg DNA

KIRREL3-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
4-Chloro-7-fluoro-6-nitroquinazoline
PC100329-01 100 mg

4-Chloro-7-fluoro-6-nitroquinazoline

Sign In for Pricing
View Details