Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus UPF0295 protein BC_0520 (BC_0520)

This Recombinant Bacillus cereus UPF0295 protein BC_0520 (BC_0520) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

UPF0295 protein BC_0520

UniProt

Q81I77

Expression Region

1-118

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRDLEGKEFDEKYNKKSYKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-100 1x 100 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF647 conjugate, 0.1mg/mL
BNC470499-100 1x 100 µL

Cytokeratin 14 (LL002), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1174), CF740 conjugate, 0.1mg/mL
BNC741174-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1174), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details