Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

Q8ZIX8

Expression Region

1-118

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQVPKRSDEPIFWGLFGAGGMWGAIIAPVIILLVAILLPLGAFPGDALSYERILAFCQS FIGRVFLLLMIILPLWCGLHRIHHAMHDLKIHVPAGKWVFYGLAAILSVVTFIGVLTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse MCM6 Protein, His (Fc)-Avi-tagged
MCM6-5414M 50 µg

Recombinant Mouse MCM6 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
RSPRY1 Protein Vector (Human) (pPB-C-His)
PV036465 500 ng

RSPRY1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
E.COND.RET.355X37CARD-T1-P16 Pipe Markers for Water
N003483 3 Card (3 Marker (s) x 1 Card)

E.COND.RET.355X37CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Anti-PDK1 Rabbit Monoclonal Antibody
MA4249-.1 100 µL

Anti-PDK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
B3gnt1 sgRNA CRISPR Lentivector set (Rat)
K6602801 3x 1.0 µg

B3gnt1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Fxr2 Rat shRNA Plasmid (Locus ID 287433)
TR704137 1 Kit

Fxr2 Rat shRNA Plasmid (Locus ID 287433)

Sign In for Pricing
View Details