Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein C7orf23 (C7orf23)

This Recombinant Human Transmembrane protein C7orf23 (C7orf23) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Transmembrane protein C7orf23

UniProt

Q9BU79

Expression Region

1-118

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPL NIFFAVCISLSSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF647 conjugate, 0.1mg/mL
BNC472786-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1b (RIV12), CF568 conjugate, 0.1mg/mL
BNC680317-500 1x 500 µL

CD1b (RIV12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF488A conjugate, 0.1mg/mL
BNC882600-100 1x 100 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details