Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNR025C (YNR025C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNR025C (YNR025C) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YNR025C

UniProt

P53726

Expression Region

1-119

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNTKKILHNALYYVLIIIYEYVLLLVHCLRYFFEFLFLFLPLWLVFFFLMLSLNNLSRS YSSSPSSWLPVNSLSLASLFSSSFCSPSSNFLFLEPLSSELSPKVFLPLITPSGFRSSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR562780 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
NLRC5 Human Gene Knockout Kit (CRISPR)
KN214810 1 Kit

NLRC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5Alpha-Cholestan-3Alpha-ol-2,2,3,4,4-d5
TRC-C431743-5MG 5 mg

5Alpha-Cholestan-3Alpha-ol-2,2,3,4,4-d5

Sign In for Pricing
View Details
Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF405S conjugate, 0.1mg/mL
BNC041058-500 1x 500 µL

Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS802236 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
Spectrodensitometer BSDM-1303
BSDM-1303 1 Unit

Spectrodensitometer BSDM-1303

Sign In for Pricing
View Details