Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNR025C (YNR025C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNR025C (YNR025C) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YNR025C

UniProt

P53726

Expression Region

1-119

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNTKKILHNALYYVLIIIYEYVLLLVHCLRYFFEFLFLFLPLWLVFFFLMLSLNNLSRS YSSSPSSWLPVNSLSLASLFSSSFCSPSSNFLFLEPLSSELSPKVFLPLITPSGFRSSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatocyte Specific Antigen (HSA133), CF488A conjugate, 0.1mg/mL
BNC880133-500 1x 500 µL

Hepatocyte Specific Antigen (HSA133), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-(2-Pyridyldithio)propionic Acid N-Succinimidyl Ester
TRC-P996850-500MG 500 mg

3-(2-Pyridyldithio)propionic Acid N-Succinimidyl Ester

Sign In for Pricing
View Details
CD299 (CLEC4M) (NM_214675) Human Recombinant Protein
TP311716L 1 mg

CD299 (CLEC4M) (NM_214675) Human Recombinant Protein

Sign In for Pricing
View Details
9,10-Dichlorophenanthrene
TRC-D435315-25MG 25 mg

9,10-Dichlorophenanthrene

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684), CF640R conjugate, 0.1mg/mL
BNC400684-500 1x 500 µL

CD68 (C68/684), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details