Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML1176 (ML1176)

This Recombinant Uncharacterized protein ML1176 (ML1176) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Uncharacterized protein ML1176

UniProt

P54133

Expression Region

1-119

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRPETPQAPDFDFEKSRTALLGYRIMAWTTGIWLIALCYEIVSHLVFHHEIRWIEVVHG WVYFVYVLTAFNLAIKVRWPIGKTVGVLLAGTVPLLGIIVEHFQTKDVKTRFGLRHSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)
MBS1264627-01 0.02 mg (E-Coli)

Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)
MBS1264627-02 0.02 mg (Yeast)

Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)
MBS1264627-03 0.1 mg (E-Coli)

Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)
MBS1264627-04 0.1 mg (Yeast)

Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)
MBS1264627-05 0.02 mg (Baculovirus)

Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)
MBS1264627-06 0.02 mg (Mammalian-Cell)

Recombinant Erwinia tasmaniensis Inosose dehydratase (iolE)

Sign In for Pricing
View Details