Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

P0A8Q5

Expression Region

1-119

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCDFP 15 Antibody
orb1312227 100 µL

GCDFP 15 Antibody

Sign In for Pricing
View Details
Pkp1 (NM_019645) Mouse Tagged ORF Clone
MG223472 10 µg

Pkp1 (NM_019645) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Serine/Threonine-protein kinase VRK2 (VRK2) Antibody
abx325525-01 50 µg

Serine/Threonine-protein kinase VRK2 (VRK2) Antibody

Sign In for Pricing
View Details
Serine/Threonine-protein kinase VRK2 (VRK2) Antibody
abx325525-02 100 µg

Serine/Threonine-protein kinase VRK2 (VRK2) Antibody

Sign In for Pricing
View Details
ABHD2 CytoSection
TS410637P5 25 Slides

ABHD2 CytoSection

Sign In for Pricing
View Details
Cacnb4 (NM_146123) Mouse Tagged ORF Clone Lentiviral Particle
MR207780L4V 200 µL

Cacnb4 (NM_146123) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details