Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Phage shock protein C (pspC)

This Recombinant Escherichia coli Phage shock protein C (pspC) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Phage shock protein C

UniProt

P0AFN2

Expression Region

1-119

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dounce Tissue grinder 7ml
HOM3582 2 / PCK

Dounce Tissue grinder 7ml

Sign In for Pricing
View Details
Survivin (API4, IAP4, Apoptosis inhibitor 4, Apoptosis inhibitor survivin, EPR-1, survivin, survivin variant 3 alpha, baculoviral IAP repeat-containing 5,) (HRP)
MBS6404670-01 0.1 mL

Survivin (API4, IAP4, Apoptosis inhibitor 4, Apoptosis inhibitor survivin, EPR-1, survivin, survivin variant 3 alpha, baculoviral IAP repeat-containing 5,) (HRP)

Sign In for Pricing
View Details
Survivin (API4, IAP4, Apoptosis inhibitor 4, Apoptosis inhibitor survivin, EPR-1, survivin, survivin variant 3 alpha, baculoviral IAP repeat-containing 5,) (HRP)
MBS6404670-02 5x 0.1 mL

Survivin (API4, IAP4, Apoptosis inhibitor 4, Apoptosis inhibitor survivin, EPR-1, survivin, survivin variant 3 alpha, baculoviral IAP repeat-containing 5,) (HRP)

Sign In for Pricing
View Details
Recombinant Mouse Alpha-2-MRAP/LRPAP1 Protein
MBS9146836-01 0.01 mg

Recombinant Mouse Alpha-2-MRAP/LRPAP1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Alpha-2-MRAP/LRPAP1 Protein
MBS9146836-02 0.02 mg

Recombinant Mouse Alpha-2-MRAP/LRPAP1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Alpha-2-MRAP/LRPAP1 Protein
MBS9146836-03 0.05 mg

Recombinant Mouse Alpha-2-MRAP/LRPAP1 Protein

Sign In for Pricing
View Details