Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

P0A8Q4

Expression Region

1-119

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS-19 Lentiviral Activation Particles (m2)
sc-433757-LAC-2 200 µL

ADAMTS-19 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
PCDHA3 Human shRNA Plasmid Kit (Locus ID 56145)
TR302635 1 Kit

PCDHA3 Human shRNA Plasmid Kit (Locus ID 56145)

Sign In for Pricing
View Details
Recombinant Human C3orf15 protein, His-tagged
C3orf15-3951H 25 µg

Recombinant Human C3orf15 protein, His-tagged

Sign In for Pricing
View Details
RAB8A Rabbit Polyclonal Antibody
E10G03721 100 µL

RAB8A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Osbp2 ORF Vector (Rat) (pORF)
35749016 1.0 µg DNA

Osbp2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
HNF4 alpha (pS313) Blocking Peptide
MBS8207984-01 1 mg

HNF4 alpha (pS313) Blocking Peptide

Sign In for Pricing
View Details