Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

P0A8Q4

Expression Region

1-119

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-POGLUT3 Antibody Picoband® Fluoro550 Conjugated
A15507-1-Fluoro550 100 µg/Vial

Anti-POGLUT3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
ARMER Antibody
253478 0.1 mg

ARMER Antibody

Sign In for Pricing
View Details
ACTR1A (ARP1 Actin-Related Protein 1 Homolog A, Centractin Alpha (Yeast), ARP1, CTRN1) (Biotin)
MBS6444877-01 0.1 mL

ACTR1A (ARP1 Actin-Related Protein 1 Homolog A, Centractin Alpha (Yeast), ARP1, CTRN1) (Biotin)

Sign In for Pricing
View Details
ACTR1A (ARP1 Actin-Related Protein 1 Homolog A, Centractin Alpha (Yeast), ARP1, CTRN1) (Biotin)
MBS6444877-02 5x 0.1 mL

ACTR1A (ARP1 Actin-Related Protein 1 Homolog A, Centractin Alpha (Yeast), ARP1, CTRN1) (Biotin)

Sign In for Pricing
View Details
COX11P CRISPRa sgRNA lentivector (set of three targets)(Human)
55871121 3x 1.0µg DNA

COX11P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
smooth muscle Myosin heavy chain 11 (MYH11) Human siRNA Oligo Duplex (Locus ID 4629)
SR303041 1 Kit

smooth muscle Myosin heavy chain 11 (MYH11) Human siRNA Oligo Duplex (Locus ID 4629)

Sign In for Pricing
View Details