Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

P0A8Q4

Expression Region

1-119

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti-Human CD45RO, PE-Cy5 Conjugated mAb.
E16HC0456-100 100 Tests

Mouse anti-Human CD45RO, PE-Cy5 Conjugated mAb.

Sign In for Pricing
View Details
PPP1R13B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1705706 1.0 µg DNA

PPP1R13B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral human MSC shRNA (UAS) - Lentiviral human MSC shRNA (UAS, iRFP) plasmid
GTR15136276 1 Vial

Lentiviral human MSC shRNA (UAS) - Lentiviral human MSC shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SNRPB (NM_198216) Human Over-expression Lysate
LS006628-100ug 100 µg

SNRPB (NM_198216) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF498 Antibody
orb223325-01 25 µg

ZNF498 Antibody

Sign In for Pricing
View Details
ZNF498 Antibody
orb223325-02 50 µg

ZNF498 Antibody

Sign In for Pricing
View Details