Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phage shock protein C (pspC)

This Recombinant Phage shock protein C (pspC) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Phage shock protein C

UniProt

P0AFN5

Expression Region

1-119

Origin

Shigella flexneri

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Romosozumab Antibody
orb2695772-01 1 mg

Romosozumab Antibody

Sign In for Pricing
View Details
Romosozumab Antibody
orb2695772-02 5 mg

Romosozumab Antibody

Sign In for Pricing
View Details
Romosozumab Antibody
orb2695772-03 10 mg

Romosozumab Antibody

Sign In for Pricing
View Details
Romosozumab Antibody
orb2695772-04 25 mg

Romosozumab Antibody

Sign In for Pricing
View Details
Romosozumab Antibody
orb2695772-05 50 mg

Romosozumab Antibody

Sign In for Pricing
View Details
UNC5H3 (F-4) Alexa Fluor® 594
sc-515678 AF594 200 µg/mL

UNC5H3 (F-4) Alexa Fluor® 594

Sign In for Pricing
View Details