Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phage shock protein C (pspC)

This Recombinant Phage shock protein C (pspC) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Phage shock protein C

UniProt

P0AFN5

Expression Region

1-119

Origin

Shigella flexneri

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2',3,5,7-Tetrahydroxyflavone
TN2690 10 mg

2',3,5,7-Tetrahydroxyflavone

Sign In for Pricing
View Details
H-Arg-4MβNA (hydrochloride salt)
sc-300781A 1 g

H-Arg-4MβNA (hydrochloride salt)

Sign In for Pricing
View Details
Anti-Human THSD1/Thrombospondin type-1 domain-containing protein 1
IT-010-017M1-01 0.1 mg

Anti-Human THSD1/Thrombospondin type-1 domain-containing protein 1

Sign In for Pricing
View Details
Anti-Human THSD1/Thrombospondin type-1 domain-containing protein 1
IT-010-017M1-02 0.5 mg

Anti-Human THSD1/Thrombospondin type-1 domain-containing protein 1

Sign In for Pricing
View Details
BEST2 Polyclonal Antibody
BT-AP14450-01 20 µL

BEST2 Polyclonal Antibody

Sign In for Pricing
View Details
BEST2 Polyclonal Antibody
BT-AP14450-02 50 µL

BEST2 Polyclonal Antibody

Sign In for Pricing
View Details