Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae NADH-quinone oxidoreductase subunit A (nuoA)

This Recombinant Verminephrobacter eiseniae NADH-quinone oxidoreductase subunit A (nuoA) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit A, EC= 1.6.99.5, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1

UniProt

A1WLP4

Expression Region

1-119

Origin

Verminephrobacter eiseniae (strain EF01-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLDQYLPVLLFILVGIAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVR YYLVAILFILFDLEIAFLFPWAVTLQQVGMAGFVAVLIFLTILVVGFAYEWKKGALDWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF594 conjugate, 0.1mg/mL
BNC940520-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/765), CF405S conjugate, 0.1mg/mL
BNC040765-500 1x 500 µL

Chromogranin A (CHGA/765), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details