Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Fumarate reductase subunit D (frdD)

This Recombinant Enterobacter sp. Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

A4W5P8

Expression Region

1-119

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWSAIVAPVIILLVAILLPLGLFPGEALGYERVLAFAS SFIGRVFIFLMIVLPLWLGLHRIHHAMHDLKIHVPNGKWVFYGLATILTVVTLVAIVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZRANB1 Human Gene Knockout Kit (CRISPR)
KN420808 1 Kit

ZRANB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), Biotin conjugate, 0.1mg/mL
BNCB2886-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SUMO3/SMT3A Protein (aa 2-92, His Tag)
PKSH033069-01 10 µg

Recombinant Human SUMO3/SMT3A Protein (aa 2-92, His Tag)

Sign In for Pricing
View Details
Recombinant Human SUMO3/SMT3A Protein (aa 2-92, His Tag)
PKSH033069-02 50 µg

Recombinant Human SUMO3/SMT3A Protein (aa 2-92, His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1+S2 ECD (D80A, K417N, E484K, N501Y, D614G, A701V) (His Tag)
PKSV030360 100 µg

Recombinant SARS-CoV-2 Spike S1+S2 ECD (D80A, K417N, E484K, N501Y, D614G, A701V) (His Tag)

Sign In for Pricing
View Details
FOLR1 Human Recombinant Protein
TP721290 25 µg

FOLR1 Human Recombinant Protein

Sign In for Pricing
View Details