Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Fumarate reductase subunit D (frdD)

This Recombinant Enterobacter sp. Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

A4W5P8

Expression Region

1-119

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWSAIVAPVIILLVAILLPLGLFPGEALGYERVLAFAS SFIGRVFIFLMIVLPLWLGLHRIHHAMHDLKIHVPNGKWVFYGLATILTVVTLVAIVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Pleura
CS500965 5x 5 µm

Frozen Tissue Sections, Pleura

Sign In for Pricing
View Details
Benchtop High Speed Centrifuge BCBH-305
BCBH-305 1 Unit

Benchtop High Speed Centrifuge BCBH-305

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF640R conjugate, 0.1mg/mL
BNC401448-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/1931), CF640R conjugate, 0.1mg/mL
BNC403644-100 1x 100 µL

CD3e (T-Cell Marker) (rC3e/1931), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phantolide
TRC-P294650-50MG 50 mg

Phantolide

Sign In for Pricing
View Details
Smim12 (NM_030252) Mouse Tagged ORF Clone
MG200242 10 µg

Smim12 (NM_030252) Mouse Tagged ORF Clone

Sign In for Pricing
View Details