Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae Fumarate reductase subunit D (frdD)

This Recombinant Salmonella arizonae Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

A9MFR0

Expression Region

1-119

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-500 1x 500 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF405S conjugate, 0.1mg/mL
BNC040201-500 1x 500 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (CEA31), CF740 conjugate, 0.1mg/mL
BNC740670-100 1x 100 µL

CD66 (CEA) (CEA31), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details