Recombinant Leptothrix cholodnii NADH-quinone oxidoreductase subunit A (nuoA)
This Recombinant Leptothrix cholodnii NADH-quinone oxidoreductase subunit A (nuoA) spans the amino acid sequence from region 1-119.
Product Specifications
Product Name Alternative
NADH-quinone oxidoreductase subunit A, EC= 1.6.99.5, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1
UniProt
B1Y827
Expression Region
1-119
Origin
Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6) )
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLENYLPVILFILVGVGVGVAPQVLGFLLGPRRPYAAKNSPYECGFEAFEDARMKFDVR YYLVAILFILFDLEIAFLFPWAVSLREIGATGFWAMMIFLGILVVGFVYEWKKGALDWE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882557-100 1x 100 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 