Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0456 (AF_0456)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0456 (AF_0456) spans the amino acid sequence from region 33-151.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0456

UniProt

O29793

Expression Region

33-151

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LNISLNEDMKNMAIGFAGGISGSGHICGALWGSIAAASLYTMKMMGDRRKIQNPLERYMP VYAKCAGIYRKFVELNGSPNCGDLNPNLDLVSVEQRRKCMEIVSRAVEITLSSLKDQKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAE1 Mouse Monoclonal Antibody [Clone 6C7]
E45M16797V-2 50 µL

SAE1 Mouse Monoclonal Antibody [Clone 6C7]

Sign In for Pricing
View Details
CDK14 3'UTR Luciferase Stable Cell Line
TU004071 1.0 mL

CDK14 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GALT Rabbit pAb, PerCP-Cy7 conjugated
orb2866140 100 µL

GALT Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
IgA ELISA Kit (Bovine)
OKIA00004-96W 1x 96 Well Plate

IgA ELISA Kit (Bovine)

Sign In for Pricing
View Details
Lentiviral human SLC4A2 shRNA (UAS) - Lentiviral human SLC4A2 shRNA (UAS, iRFP) (25)
GTR15108314 1 Vial

Lentiviral human SLC4A2 shRNA (UAS) - Lentiviral human SLC4A2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
PSMC5 Antibody, HRP conjugated
MBS7052342-01 0.05 mg

PSMC5 Antibody, HRP conjugated

Sign In for Pricing
View Details