Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cupriavidus pinatubonensis NADH-quinone oxidoreductase subunit A (nuoA)

This Recombinant Cupriavidus pinatubonensis NADH-quinone oxidoreductase subunit A (nuoA) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit A, EC= 1.6.99.5, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1

UniProt

Q473U3

Expression Region

1-119

Origin

Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLEAYFPVLIFIIFGVVLGIALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVR YYLIAILFILFDLETAFLFPWGVALREIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL
BNC700774-500 1x 500 µL

HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF647 conjugate, 0.1mg/mL
BNC470960-500 1x 500 µL

MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF405S conjugate, 0.1mg/mL
BNC040955-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details