Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative increased recombination centers protein 16 (IRC16)

This Recombinant Saccharomyces cerevisiae Putative increased recombination centers protein 16 (IRC16) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Putative increased recombination centers protein 16

UniProt

Q6B0V8

Expression Region

1-119

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCFSISFNRASFFSAAAPCTSSIPDFALIRPGVAMDSSLDEKNIHRPMIPNAATILMAW LLLTICFIPSFLAQSVQTFLFTNHQPSRLLVFITHVYCLMIKPFVLYFWFLFPLRLPGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-100 1x 100 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF647 conjugate, 0.1mg/mL
BNC471924-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF594 conjugate, 0.1mg/mL
BNC941683-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details