Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

Q8FAL7

Expression Region

1-119

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPIGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS801433 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: 3G4]
AM09001PU-N 100 µL

CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: 3G4]

Sign In for Pricing
View Details
Anti-PGM3
Y058856 100 µg

Anti-PGM3

Sign In for Pricing
View Details
CLCN4 (NM_001830) Human Over-expression Lysate
LY419731 100 µg

CLCN4 (NM_001830) Human Over-expression Lysate

Sign In for Pricing
View Details
Benzoylaconine
TRC-B207760-1MG 1 mg

Benzoylaconine

Sign In for Pricing
View Details
Quinoline Yellow
TRC-Q701040-1G 1 g

Quinoline Yellow

Sign In for Pricing
View Details