Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

Q8FAL7

Expression Region

1-119

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPIGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5HT7 Receptor (HTR7) (C-term) Rabbit Polyclonal Antibody
AP52131PU-N 400 µL

5HT7 Receptor (HTR7) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), CF740 conjugate, 0.1mg/mL
BNC741882-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COPS8 Rabbit Polyclonal Antibody
ER2001-29 100 µL

COPS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GRAMD1B activation kit by CRISPRa
GA111521 1 Kit

Human GRAMD1B activation kit by CRISPRa

Sign In for Pricing
View Details
Human IL-17F, Tag Free
HA210716-01 20 µg

Human IL-17F, Tag Free

Sign In for Pricing
View Details
Human IL-17F, Tag Free
HA210716-02 50 µg

Human IL-17F, Tag Free

Sign In for Pricing
View Details