Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

P67646

Expression Region

1-119

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), Biotin conjugate, 0.1mg/mL
BNCB1974-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EASYStep Pro Human Carcinoembryonic Antigen (CEA) ELISA Kit
RDEp-CEA-Hu 96 Tests

EASYStep Pro Human Carcinoembryonic Antigen (CEA) ELISA Kit

Sign In for Pricing
View Details
IL17RB Human
OM296458-01 10 µg

IL17RB Human

Sign In for Pricing
View Details
IL17RB Human
OM296458-02 2 µg

IL17RB Human

Sign In for Pricing
View Details
IL17RB Human
OM296458-03 1 mg

IL17RB Human

Sign In for Pricing
View Details
MAP1LC3C Polyclonal Antibody
E-AB-13378-01 20 µL

MAP1LC3C Polyclonal Antibody

Sign In for Pricing
View Details