Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

P67646

Expression Region

1-119

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]
TA803089AM 100 µL

ARL3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]

Sign In for Pricing
View Details
CDKN1A interacting zinc finger protein 1 (CIZ1) Human Gene Knockout Kit (CRISPR)
KN223437BN 1 Kit

CDKN1A interacting zinc finger protein 1 (CIZ1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tryptophan Hydroxylase 1 (TPH1) Recombinant Rabbit monoclonal Antibody [SC53-07]
ET1610-37-50UL 50 µL

Tryptophan Hydroxylase 1 (TPH1) Recombinant Rabbit monoclonal Antibody [SC53-07]

Sign In for Pricing
View Details
Mouse Dph6 activation kit by CRISPRa
GA206879 1 Kit

Mouse Dph6 activation kit by CRISPRa

Sign In for Pricing
View Details
Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate
LC431501 20 µg

Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Acetyl-D-Glucosamine 3,4-Diacetate
TRC-A178215-25MG 25 mg

N-Acetyl-D-Glucosamine 3,4-Diacetate

Sign In for Pricing
View Details