Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D, Fumarate reductase 13 kDa hydrophobic protein

UniProt

P67646

Expression Region

1-119

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Phthalimidoacetoacetic Acid Ethyl Ester-13C
TRC-P384637-2.5MG 2.5 mg

4-Phthalimidoacetoacetic Acid Ethyl Ester-13C

Sign In for Pricing
View Details
Calcium Levofolinate
TRC-C145635-5MG 5 mg

Calcium Levofolinate

Sign In for Pricing
View Details
Human INTS5 activation kit by CRISPRa
GA112984 1 Kit

Human INTS5 activation kit by CRISPRa

Sign In for Pricing
View Details
Delmadinone
TRC-D230655-10MG 10 mg

Delmadinone

Sign In for Pricing
View Details
2-Bromophenetole
TRC-B686163-500MG 500 mg

2-Bromophenetole

Sign In for Pricing
View Details
Polystyrene A FP
HA12516007.5G 5 g

Polystyrene A FP

Sign In for Pricing
View Details