Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR232C (YBR232C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR232C (YBR232C) spans the amino acid sequence from region 1-119.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YBR232C

UniProt

P38327

Expression Region

1-119

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFILAEVSDFILDIVAPLCPTISEACLTKHSIRKCTSEGTLSGESWSLSEWLSASFRATR LISASSCSSLVSSPFFLLSVLGETSTVVGVVVIDGFVVSVDIIELKSITERLFNAALDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF640R conjugate, 0.1mg/mL
BNC402034-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL
BNC400950-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (MYD712), CF740 conjugate, 0.1mg/mL
BNC740712-500 1x 500 µL

MyoD1 (MYD712), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF640R conjugate, 0.1mg/mL
BNC401531-100 1x 100 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details