Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb1377c (Mb1377c)

This Recombinant Uncharacterized protein Mb1377c (Mb1377c) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb1377c

UniProt

P0A5E8

Expression Region

1-120

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTW IGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NTR1 Antibody
CPA7030-01 30 µL

Anti-NTR1 Antibody

Sign In for Pricing
View Details
Anti-NTR1 Antibody
CPA7030-02 50 μL

Anti-NTR1 Antibody

Sign In for Pricing
View Details
Anti-NTR1 Antibody
CPA7030-03 100 µL

Anti-NTR1 Antibody

Sign In for Pricing
View Details
Anti-NTR1 Antibody
CPA7030-04 200 µL

Anti-NTR1 Antibody

Sign In for Pricing
View Details
EMR1 Polyclonal Antibody Cy5 Conjugated
orb1541930 100 µL

EMR1 Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details
PLAG1 Rabbit Polyclonal Antibody
TA371968 100 µL

PLAG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details