Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb1377c (Mb1377c)

This Recombinant Uncharacterized protein Mb1377c (Mb1377c) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb1377c

UniProt

P0A5E8

Expression Region

1-120

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTW IGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFRB Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
36306065 1.0 µg DNA

PDGFRB Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
RD79995A-01 60μL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
RD79995A-02 120μL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
RD79995A-03 200μL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details
Human Carbohydrate sulfotransferase 6 (CHST6) ELISA Kit
abx506677 96 Tests

Human Carbohydrate sulfotransferase 6 (CHST6) ELISA Kit

Sign In for Pricing
View Details
SJB3-019A
B1307-5.1 10 mM (in 1mL DMSO)

SJB3-019A

Sign In for Pricing
View Details