Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yidG (yidG)

This Recombinant Inner membrane protein yidG (yidG) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Inner membrane protein yidG

UniProt

P0ADL7

Expression Region

1-120

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDSRKARRIADPGLQPERTSLAWFRTMLGYGALMALAIKHNWHQAGMLFWISIGILAIV ALILWHYTRNRNLMDVTNSDFSQFHVVRDKFLISLAVLSLAILFAVTHIHQLIVFIERVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PGRL/IGSF8 Protein (Fc Tag)
PKSM040381 100 µg

Recombinant Mouse PGRL/IGSF8 Protein (Fc Tag)

Sign In for Pricing
View Details
1,2,4-Triazole Sodium Salt
TRC-T767440-50G 50 g

1,2,4-Triazole Sodium Salt

Sign In for Pricing
View Details
LINC01205 (NM_001145553) Human Over-expression Lysate
LC428941 20 µg

LINC01205 (NM_001145553) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Chlorosalicylic Acid
TRC-C382005-50G 50 g

4-Chlorosalicylic Acid

Sign In for Pricing
View Details
ST6GALNAC6 (NM_001287003) Human Tagged ORF Clone
RG235532 10 µg

ST6GALNAC6 (NM_001287003) Human Tagged ORF Clone

Sign In for Pricing
View Details
CF®488A Azide
#92080 1x 500 µg

CF®488A Azide

Sign In for Pricing
View Details