Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yidG (yidG)

This Recombinant Inner membrane protein yidG (yidG) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Inner membrane protein yidG

UniProt

P0ADL7

Expression Region

1-120

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDSRKARRIADPGLQPERTSLAWFRTMLGYGALMALAIKHNWHQAGMLFWISIGILAIV ALILWHYTRNRNLMDVTNSDFSQFHVVRDKFLISLAVLSLAILFAVTHIHQLIVFIERVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Carboxycytosine
TRC-C177975-25MG 25 mg

5-Carboxycytosine

Sign In for Pricing
View Details
Guinea pig Matrix Metalloproteinase 8 (MMP8) ELISA Kit
RDR-MMP8-Gu-01 96 Tests

Guinea pig Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Matrix Metalloproteinase 8 (MMP8) ELISA Kit
RDR-MMP8-Gu-02 48 Tests

Guinea pig Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details
CENPA Human Gene Knockout Kit (CRISPR)
KN401602 1 Kit

CENPA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Trak2 activation kit by CRISPRa
GA208630 1 Kit

Mouse Trak2 activation kit by CRISPRa

Sign In for Pricing
View Details
Smc3 Antibody
KC-184-01 50 μL

Smc3 Antibody

Sign In for Pricing
View Details