Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit 3

This Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit 3 spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 3, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3, NDH-1 subunit 3, NDH-C

UniProt

A5GIB3

Expression Region

1-120

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQDGERQLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), CF405S conjugate, 0.1mg/mL
BNC040762-500 1x 500 µL

IgM Immunoglobulin (Cocktail), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF568 conjugate, 0.1mg/mL
BNC682868-100 1x 100 µL

Serum Amyloid A (SAA/2868R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details