Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A5ISN0

Expression Region

1-120

Origin

Staphylococcus aureus (strain JH9)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alg1 Mouse Gene Knockout Kit (CRISPR)
KN501132 1 Kit

Alg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(E)-Dodec-2-enoic Acid Ethyl Ester
TRC-D525560-250MG 250 mg

(E)-Dodec-2-enoic Acid Ethyl Ester

Sign In for Pricing
View Details
ADAMTS16 Human Gene Knockout Kit (CRISPR)
KN421617 1 Kit

ADAMTS16 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EvaEZTM Fluorometric DNA Polymerase Activity Assay (200 rxn)
#29051 2x 1 mL

EvaEZTM Fluorometric DNA Polymerase Activity Assay (200 rxn)

Sign In for Pricing
View Details
Smooth Muscle Actin (1A4), CF640R conjugate, 0.1mg/mL
BNC400665-500 1x 500 µL

Smooth Muscle Actin (1A4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(-)-Strigolactone GR24
TRC-S687610-5MG 5 mg

(-)-Strigolactone GR24

Sign In for Pricing
View Details