Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A6U1G8

Expression Region

1-120

Origin

Staphylococcus aureus (strain JH1)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THEG5 Human Gene Knockout Kit (CRISPR)
KN431843 1 Kit

THEG5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LOC102641613 Mouse Monoclonal Antibody [Clone ID: 34-5-8S]
CL053P 250 µg

LOC102641613 Mouse Monoclonal Antibody [Clone ID: 34-5-8S]

Sign In for Pricing
View Details
HIBCH (NM_014362) Human Over-expression Lysate
LY402324 100 µg

HIBCH (NM_014362) Human Over-expression Lysate

Sign In for Pricing
View Details
Vacuum Oven BOVA-5904
BOVA-5904 1 Unit

Vacuum Oven BOVA-5904

Sign In for Pricing
View Details
NUMB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A7]
TA501614BM 100 µL

NUMB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A7]

Sign In for Pricing
View Details
Cyclin A2 (E67), CF488A conjugate, 0.1mg/mL
BNC880673-100 1x 100 µL

Cyclin A2 (E67), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details