Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A6U1G8

Expression Region

1-120

Origin

Staphylococcus aureus (strain JH1)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS701514 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
SFMBT2 Human Gene Knockout Kit (CRISPR)
KN418680 1 Kit

SFMBT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WNT8A Recombinant Rabbit Monoclonal Antibody [PSH0-39]
HA721341 100 µL

WNT8A Recombinant Rabbit Monoclonal Antibody [PSH0-39]

Sign In for Pricing
View Details
Benzofuran-3(2H)-one
TRC-B285433-500MG 500 mg

Benzofuran-3(2H)-one

Sign In for Pricing
View Details
Halo Tag, AlpHcAbs® Rabbit antibody
HA710102 100 µg

Halo Tag, AlpHcAbs® Rabbit antibody

Sign In for Pricing
View Details
ATP6V0C (C-term) Rabbit Polyclonal Antibody
AP50304PU-N 400 µL

ATP6V0C (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details