Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A6U1G8

Expression Region

1-120

Origin

Staphylococcus aureus (strain JH1)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Oxo-4-(3-pyridyl)butanal
TRC-O859250-2.5MG 2.5 mg

4-Oxo-4-(3-pyridyl)butanal

Sign In for Pricing
View Details
NKX2.8 (NKX28/2547), CF488A conjugate, 0.1mg/mL
BNC882547-500 1x 500 µL

NKX2.8 (NKX28/2547), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DHPS (NM_001930) Human Over-expression Lysate
LY400714 100 µg

DHPS (NM_001930) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS501592 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Recombinant LIN28B Antibody
RC-15406-01 50 μL

Recombinant LIN28B Antibody

Sign In for Pricing
View Details
Recombinant LIN28B Antibody
RC-15406-02 100 µL

Recombinant LIN28B Antibody

Sign In for Pricing
View Details