Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A7X204

Expression Region

1-120

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11ORF46 (ARL14EP) (NM_152316) Human Mass Spec Standard
PH308413 10 µg

C11ORF46 (ARL14EP) (NM_152316) Human Mass Spec Standard

Sign In for Pricing
View Details
Phospho-ATG9A (Ser735) Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2412854 100 µL

Phospho-ATG9A (Ser735) Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
PCTAIRE-2 Lentiviral Activation Particles (h)
sc-406469-LAC 200 µL

PCTAIRE-2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Fish creatine phosphokinase (CPK) ELISA Kit
MBS1603089-01 48 Well

Fish creatine phosphokinase (CPK) ELISA Kit

Sign In for Pricing
View Details
Fish creatine phosphokinase (CPK) ELISA Kit
MBS1603089-02 96 Well

Fish creatine phosphokinase (CPK) ELISA Kit

Sign In for Pricing
View Details
Fish creatine phosphokinase (CPK) ELISA Kit
MBS1603089-03 5x 96 Well

Fish creatine phosphokinase (CPK) ELISA Kit

Sign In for Pricing
View Details