Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A7X204

Expression Region

1-120

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Normal mouse IgG1-APC
sc-2888 100 Tests in 2 mL

Normal mouse IgG1-APC

Sign In for Pricing
View Details
Her2 (ERBB2) pTyr1112 Rabbit Polyclonal Antibody
AP55859PU-N 100 µL

Her2 (ERBB2) pTyr1112 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adiponectin Recombinant Protein
orb1228565 0.05 mg

Adiponectin Recombinant Protein

Sign In for Pricing
View Details
DGAT2L4 antibody - C-terminal region
MBS3207361-01 0.1 mL

DGAT2L4 antibody - C-terminal region

Sign In for Pricing
View Details
DGAT2L4 antibody - C-terminal region
MBS3207361-02 5x 0.1 mL

DGAT2L4 antibody - C-terminal region

Sign In for Pricing
View Details
Slc12a1 siRNA Oligos set (Mouse)
43870174 3x 5 nmol

Slc12a1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details