Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A7X204

Expression Region

1-120

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NFU1 Protein
BP2118-50ug 50 µg

Recombinant Human NFU1 Protein

Sign In for Pricing
View Details
RABGGTA Polyclonal Antibody, FITC Conjugated
A60512-100 100 µL

RABGGTA Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
EHBP1L1 Double Nickase Plasmid (m2)
sc-431109-NIC-2 20 µg

EHBP1L1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rnase1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
40192151 3x 1.0 µg DNA

Rnase1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Rat Serine/threonine-protein kinase BRSK1 (Brsk1)
MBS1078372-01 0.02 mg (E-Coli)

Recombinant Rat Serine/threonine-protein kinase BRSK1 (Brsk1)

Sign In for Pricing
View Details
Recombinant Rat Serine/threonine-protein kinase BRSK1 (Brsk1)
MBS1078372-02 0.02 mg (Yeast)

Recombinant Rat Serine/threonine-protein kinase BRSK1 (Brsk1)

Sign In for Pricing
View Details