Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus alba NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

This Recombinant Populus alba NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3

UniProt

Q14FF2

Expression Region

1-120

Origin

Populus alba (White poplar)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLLYEYDIFWAFLIISSVIPILAFLISGLLSPIRKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog