Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q2FH87

Expression Region

1-120

Origin

Staphylococcus aureus (strain USA300)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osteoadherin, CT (Osteoadherin Proteoglycan, OSAD, Keratan Sulfate Proteoglycan Osteomodulin, KSPG Osteomodulin, Osteomodulin, OMD, SLRR2C, UNQ190/PRO216) (MaxLight 650)
MBS6491175-01 0.1 mL

Osteoadherin, CT (Osteoadherin Proteoglycan, OSAD, Keratan Sulfate Proteoglycan Osteomodulin, KSPG Osteomodulin, Osteomodulin, OMD, SLRR2C, UNQ190/PRO216) (MaxLight 650)

Sign In for Pricing
View Details
Osteoadherin, CT (Osteoadherin Proteoglycan, OSAD, Keratan Sulfate Proteoglycan Osteomodulin, KSPG Osteomodulin, Osteomodulin, OMD, SLRR2C, UNQ190/PRO216) (MaxLight 650)
MBS6491175-02 5x 0.1 mL

Osteoadherin, CT (Osteoadherin Proteoglycan, OSAD, Keratan Sulfate Proteoglycan Osteomodulin, KSPG Osteomodulin, Osteomodulin, OMD, SLRR2C, UNQ190/PRO216) (MaxLight 650)

Sign In for Pricing
View Details
SLC39A12 Rabbit Polyclonal Antibody (FITC)
orb2119674 100 µL

SLC39A12 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Chloranthus spicatus Maturase K (matK), partial
MBS1104771 Inquire

Recombinant Chloranthus spicatus Maturase K (matK), partial

Sign In for Pricing
View Details
Olfr923 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4147104 1.0 µg DNA

Olfr923 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Ovine Citrulline ELISA Kit-Competitive
EK1F544 96 Tests

Ovine Citrulline ELISA Kit-Competitive

Sign In for Pricing
View Details