Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

This Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q2FH87

Expression Region

1-120

Origin

Staphylococcus aureus (strain USA300)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CK068 rabbit pAb Antibody
orb2305774-01 50 µL

CK068 rabbit pAb Antibody

Sign In for Pricing
View Details
CK068 rabbit pAb Antibody
orb2305774-02 100 µL

CK068 rabbit pAb Antibody

Sign In for Pricing
View Details
DIAPH2 Rabbit Polyclonal Antibody
orb213850-01 30 µL

DIAPH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIAPH2 Rabbit Polyclonal Antibody
orb213850-02 50 μL

DIAPH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIAPH2 Rabbit Polyclonal Antibody
orb213850-03 100 µL

DIAPH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIAPH2 Rabbit Polyclonal Antibody
orb213850-04 200 µL

DIAPH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details