Recombinant Prochlorococcus marinus NAD (P) H-quinone oxidoreductase subunit 3 (ndhC)
This Recombinant Prochlorococcus marinus NAD (P) H-quinone oxidoreductase subunit 3 (ndhC) spans the amino acid sequence from region 1-120.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 3, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3, NDH-1 subunit 3, NDH-C
UniProt
Q31CN8
Expression Region
1-120
Origin
Prochlorococcus marinus (strain MIT 9312)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFLLTGYEYFLGFLLIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 