Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YBR255C-A (YBR255C-A)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YBR255C-A (YBR255C-A) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Uncharacterized protein YBR255C-A

UniProt

Q3E776

Expression Region

1-120

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGNVLPIHYDPKTVKQLTKEITVASCIGAAQGALFSIASALLLRRFSSVYRNVRTQVRV FYHCSWISMGAVFRADKQLLKFQTNYYREEQKRREKIMDEAAERGLFLEDESLNSSRSTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1131), CF647 conjugate, 0.1mg/mL
BNC471131-100 1x 100 µL

CD45RA (PTPRC/1131), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR1195 + 31G7), CF594 conjugate, 0.1mg/mL
BNC941200-500 1x 500 µL

EGFR (GFR1195 + 31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF594 conjugate, 0.1mg/mL
BNC941576-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (139H2), CF740 conjugate, 0.1mg/mL
BNC740925-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (139H2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF568 conjugate, 0.1mg/mL
BNC681563-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details