Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit 3 (ndhC)
This Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit 3 (ndhC) spans the amino acid sequence from region 1-120.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 3, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3, NDH-1 subunit 3, NDH-C
UniProt
Q3AN53
Expression Region
1-120
Origin
Synechococcus sp. (strain CC9605)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFALPGYDAFLGFLLIAAAVPVLALVTNKLVAPKSRAGERQLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILLVALAYAWRKGALEWS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details